Sermorelin Research GuideYADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 · not tesamorelin · not Geref-equivalent
Sermorelin is the synthetic C-terminally amidated 29-residue N-terminal fragment of human GHRH (GRF(1–29)-NH2 / hGHRH(1–29)NH2) with opened sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (PubChem CID 16132413; CAS 86168-78-7; UNII 89243S03TE; formula C149H246N44O42S; MW 3357.9 g/mol). The historical US product was the acetate salt (UNII 00IBG87IQW; CAS 114466-38-5; Geref®; FDA 1990; withdrawn on opened IUPHAR). It is not tesamorelin, not CJC-1295, not modified GRF(1–29) with extra substitutions, not intact GHRH(1–44), and not recombinant growth hormone. A research-market 10 mg vial is not established as equivalent to withdrawn Geref. Research use only. Not medical advice. Not for human use.
CID 16132413 (free base)
CAS 86168-78-7
UNII 89243S03TE
Acetate / Geref kept separate
NCT00324064 (Geref diagnostic)
Research use only
Educational information only. This page describes a laboratory research peptide corresponding, on opened registries, to the amidated GHRH(1–29) fragment sermorelin. It is not medical advice. Simple Research Peptides (SRP) materials are for laboratory research only and are not for human or veterinary use, consumption, administration, diagnosis, treatment, or therapeutic application. No human dosing, reconstitution, or administration protocol appears on this page. Historical Geref® diagnostic / pediatric labeling is opened regulatory history, not a current FDA-marketed product and not a protocol for a research-market vial. This page prints zero dose figures.
Sequence and chemical identity (opened registries only)
SRP product and index pages do not print CAS, UNII, PubChem CID, molecular formula, full sequence, or a public COA. Identity below is taken only from opened public registries and from papers / ligand pages that name sermorelin / GRF(1–29)-NH2.
Opened SRP 10 mg product page (16 August 2026): title “Sermorelin (10 mg Vial)”. Subhead: Sermorelin (10 mg Vial) — COA verified research compound. For laboratory research use only. Not for human consumption. Also known as: GRF(1-29), Sermorelin Acetate. Bullets: 10 mg lyophilized research compound in a 3 mL research vial; COA available for batch verification; high-purity research material; intended for qualified laboratory and analytical research; securely packaged; Made in the USA; For Research Use Only. Not for human or veterinary use. Description: supplied for controlled laboratory evaluation of Sermorelin within Growth Hormone Research studies. Footer: for laboratory research only; not for human or animal use, consumption, administration, diagnosis, treatment, or therapeutic application. Availability: 5 in stock (can be backordered). Price was not printed on the opened product-page markdown. Product URL: http://simpleresearchpeptides.com/product/sermorelin-10-mg-vial/.
Not printed on the opened product page and therefore not claimed as SRP-verified: the 29-aa sequence; C-terminal amide vs free acid; CAS; UNII; CID; acetate stoichiometry; a public COA file; a published laboratory dose.
Opened SRP index card (compound-research-guides, 16 August 2026): “Sermorelin (10 mg Vial)” under Growth; tagged Evidence profile. Overview: Sermorelin is the 1-29 amino-acid fragment of human GHRH and retains the portion required to stimulate pituitary growth-hormone release. Mechanism: it activates the GHRH receptor, relying on a functioning pituitary rather than directly supplying growth hormone. Evidence: human diagnostic and pediatric literature exists, including historical regulated-product use. This does not establish anti-aging or performance claims. Quality note: Sermorelin, modified GRF(1-29), and CJC-1295 are related but chemically and pharmacokinetically distinct. Last editorial review: August 2026.
Opened dedicated-guide URL http://simpleresearchpeptides.com/research-compound-directory/sermorelin-research/ returned HTTP 404. This page is written for that missing guide.
generic_name:sermorelin and brand_name:GEREF → no matches. query.intr=sermorelin totalCount 27; query.term=sermorelin totalCount 42. Most opened hits are tesamorelin / generic GHRH. Verified sermorelin (Geref) record: NCT00324064.How sermorelin is not tesamorelin, not CJC-1295, and not GH
Catalog “growth / anti-aging / secretagogue” language does not convert a research 29-mer into tesamorelin, a DAC-extended analog, or recombinant GH.
| Identity | What opened sources actually describe | Peptide? | Typical literature role |
|---|---|---|---|
| Sermorelin (this page) | 29 aa amide; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; CID 16132413; CAS 86168-78-7; UNII 89243S03TE | Yes | GHRH(1–29)-NH2. Historical Geref diagnostic / pediatric product (withdrawn). GHRHR agonist (IUPHAR). |
| Sermorelin acetate (historical product salt) | UNII 00IBG87IQW; CAS 114466-38-5; Geref® | Salt of the same 29-mer | Withdrawn US product. Not proof of an SRP lot. Kept separate on this page. |
| Intact GHRH / somatorelin | 44 aa; IUPHAR ligand 2270 | Yes (longer peptide) | Endogenous hypothalamic peptide. Not the vial. |
| Tesamorelin (TH9507) | Stabilized GHRH analog; Egrifta | Yes (different analog) | HIV-lipodystrophy literature. Not sermorelin. Most CT.gov collisions. |
| CJC-1295 DAC / no-DAC / modified GRF | Different substitutions and/or albumin-binding DAC | Yes (different designs) | Separate SRP listings. Not interchangeable. |
| Recombinant GH | Intact pituitary hormone | Protein hormone | Direct GH replacement. Opposite pharmacology class from a GHRH-receptor agonist. |
Sermorelin is a GHRH-receptor agonist, not GH. IUPHAR ligand 6998 lists a primary-target agonist interaction at human GHRH receptor (targetId 247). Prakash & Goa 1999 (PMID 18031173) print that intravenous and subcutaneous sermorelin specifically stimulate GH secretion from the anterior pituitary and that the 29-mer is “the shortest synthetic peptide with full biological activity of GHRH.” That is opened pharmacology, not a current prescription and not a protocol. Microgram-per-kilogram figures in that review are historical labeled / study conditions and are not copied here.
Historical approval is not current marketing and is not an SRP-vial indication. NCATS: US Previously Marketed, GEREF by EMD SERONO, first approved 1990. IUPHAR: approved FDA 1990; withdrawn true. openFDA current Drugs@FDA search: no matches. Opened Federal Register notice 78 FR 14095 (FR Doc 2013-04827, 4 March 2013): NDA 19-863 (GEREF diagnostic; initially approved 28 December 1990) and NDA 20-443 (GEREF pediatric GHD / growth-failure product; initially approved 26 September 1997), both held by EMD Serono, were discontinued in 2008; FDA withdrew both NDA approvals effective 18 June 2009; FDA later determined the products were not withdrawn for safety or effectiveness. Listed-drug strengths appear in that notice and are not copied here as a protocol. A withdrawn diagnostic / pediatric product does not make a research-market 10 mg vial a medicine.
Do not equate this vial with tesamorelin, CJC-1295, ipamorelin, recombinant GH, or an anti-aging protocol. Research use only.
Proposed mechanism (labeled as such)
Opened ligand and review pages support a GHRH-receptor agonist working model: the amidated 1–29 fragment binds pituitary GHRHR and stimulates endogenous GH release if the somatotroph axis is intact. It is not a treatment claim. It was not generated with an SRP 10 mg vial.
GHRHR agonist (IUPHAR)
IUPHAR ligand 6998 interaction 79224: sermorelin is an agonist at human GHRH receptor (target 247); primaryTarget true; selectivity “Not Determined”; no numeric affinity printed on the opened interactions JSON.
Historical review language
Prakash & Goa 1999 (PMID 18031173): sermorelin is the shortest synthetic peptide with full GHRH biological activity; IV and SC administration specifically stimulate anterior-pituitary GH secretion; the review discusses a diagnostic GH-stimulation context and pediatric idiopathic-GHD literature. Historical labeled / study conditions are not copied here as a protocol.
Named Geref diagnostic NCT
NCT00324064 (COMPLETED): GHRH(Geref) followed by arginine in adult GH testing. That is a named Geref diagnostic-test record. It is not an SRP-vial study and is not an instruction. Dose figures from that record are not copied here.
Not shown for an SRP 10 mg vial. Not shown: proof the SRP lot is amidated 1–29 acetate matching Geref; human PK of that lot; anti-aging, performance, or body-composition efficacy; interchangeability with tesamorelin or CJC-1295; a current FDA-marketed sermorelin product.
Where the literature actually sits
Opened ligand and review pages
IUPHAR 6998 (agonist at GHRHR; withdrawn). NCATS 89243S03TE and 00IBG87IQW. PubChem CID 16132413. Prakash & Goa 1999 (PMID 18031173). Ling / GHRH review PMID 2429796 (GHRH 44 vs C-terminal-shortened derivatives — identity context only).
Withdrawn Geref
Geref (sermorelin acetate), EMD Serono, FDA 1990. IUPHAR withdrawn. openFDA no current match. Walker 2006 (PMID 18046908) is a commentary title on adult-onset GH insufficiency — not treated as efficacy proof and not a protocol.
Do not collapse to tesamorelin
query.intr=sermorelin totalCount 27. Opened list is dominated by tesamorelin (TH9507 / Egrifta) and unspecified GHRH. Verified sermorelin (Geref) record used: NCT00324064. Unused tesamorelin examples (logged, not cited as sermorelin evidence): NCT00123253, NCT00795210 (tesamorelin arm), NCT06554717, NCT02012556.
Not a trial; not a COA
Chen et al. 2021 (PMID 33842627) is a transcriptomic drug-repurposing paper naming sermorelin for recurrent glioma. Computational. Not a clinical trial. Not used as efficacy evidence. SRP prints “Sermorelin,” AKA GRF(1-29) / Sermorelin Acetate, 10 mg, “COA available,” Made in the USA, and RUO footers, but does not display sequence, amide, CAS, UNII, salt stoichiometry, or a public COA file.
Opened records, read as they actually sit
Published study designs and historical labels are not a protocol. Microgram-per-kilogram figures are study / label conditions from those records and are not copied here.
| Study | Species / model | What was tested | Actual finding (from the opened record) | What it did not show |
|---|---|---|---|---|
| Prakash & Goa, 1999 PMID 18031173. DOI 10.2165/00063030-199912020-00007. Opened Europe PMC abstract. | Review of pediatric / diagnostic literature | Sermorelin as GHRH(1–29) | 29-aa analog; shortest synthetic peptide with full GHRH activity; IV/SC stimulate pituitary GH. Historical diagnostic / idiopathic-GHD review. | Current FDA marketing. SRP-lot identity. Anti-aging indication. A protocol. Dose figures not copied. |
| Walker, 2006 PMID 18046908. DOI 10.2147/ciia.2006.1.4.307. Opened Europe PMC record (empty abstract). | Commentary | Adult-onset GH insufficiency (title) | Title-level commentary only on the opened record. | Efficacy package. SRP vial. |
| Thorner / GHRH review, 1986 PMID 2429796. DOI 10.1016/s0300-595x(86)80012-3. Opened Europe PMC abstract. | Review | Human GHRH 44-aa amide and C-terminal-shortened derivatives | Identity context: GHRH is 44 aa or shortened forms. Distinguishes full-length GHRH from fragments. | Sermorelin-specific RCT. |
| NCT00324064. CT.gov API JSON, opened 16 August 2026. | Diagnostic; estimated n=90; COMPLETED; no results posted | GHRH(Geref) + arginine stimulation | Named Geref as the GHRH reagent in adult GH testing. | SRP-vial trial. Tesamorelin equivalence. A research-use protocol. Dose figures not copied. |
| Chen et al., 2021 PMID 33842627. DOI 10.21037/atm-20-6561. Opened Europe PMC abstract. | In-silico / transcriptomic | Sermorelin named in a glioma-repurposing screen | Computational association. | Human glioma trial. Mechanism proof. |
Human / NCT snapshot. One verified Geref diagnostic NCT (NCT00324064). Do not cite tesamorelin NCTs as sermorelin.
Gaps in the opened record
No current FDA-marketed sermorelin product
Opened openFDA: no matches. Historical Geref is withdrawn (IUPHAR).
No proof the SRP vial is Geref-equivalent acetate amide
Sequence, amide, salt, and a public COA were not printed. Acetate UNII 00IBG87IQW is a separate record.
Tesamorelin / CJC-1295 / modified GRF findings are not sermorelin
Different sequences and PK designs. Most CT.gov collisions are tesamorelin.
Anti-aging, performance, sleep, and body-composition claims are not established
Not established for a research-market lot.
PMID 33842627 is computational
Not a trial. Not used as efficacy evidence.
No opened chronic-tox package for an SRP 10 mg vial
No opened carcinogenicity package either.
| Popular claim | Status after this review |
|---|---|
| “Sermorelin is currently FDA-approved and interchangeable with Geref” | False for a research vial. Geref was approved in 1990 and is withdrawn on opened IUPHAR. openFDA: no current match. |
| “It is tesamorelin / Egrifta” | False identity. |
| “It is CJC-1295 or modified GRF” | False. Different designs. |
| “It is growth hormone” | False. GHRHR agonist; requires an intact pituitary. |
| “CT.gov 27 hits are all sermorelin trials” | False. Most opened hits are tesamorelin / generic GHRH. |
| “This page is a treatment or dosing guide” | False. Research use only. No protocol. Zero dose figures printed. |
Key papers as short cards
Prakash & Goa, 1999 — BioDrugs.
Review: 29-aa GHRH analog; historical diagnostic / pediatric GHD context. Not a protocol. Dose figures not copied. PMID 18031173.
Walker, 2006 — Clin Interv Aging.
Commentary title on adult-onset GH insufficiency. Not efficacy proof. PMID 18046908.
Thorner-context GHRH review, 1986 — Clin Endocrinol Metab.
Full-length GHRH vs shortened derivatives. Identity only. PMID 2429796.
NCT00324064 (2007–2009).
Diagnostic Geref + arginine adult GH testing. COMPLETED. No results posted. Not an SRP-vial study. Dose figures not copied. NCT00324064.
Chen et al., 2021 — Ann Transl Med.
In-silico glioma repurposing. Not a trial. PMID 33842627.
Research-use-only notes
Sermorelin is a laboratory research peptide. The historical Geref product is withdrawn and is not equivalent to a research-market vial by default. This page is educational. It does not provide dosing, reconstitution, administration, or any human-use instructions. The 10 mg mass is a vendor listing, not a published laboratory protocol.
Simple Research Peptides (SRP) materials are for laboratory research only and are not for human or veterinary use, consumption, administration, diagnosis, treatment, or therapeutic application.
Laboratory identity is the first practical issue. Opened registries describe sermorelin as CID 16132413 / CAS 86168-78-7 / UNII 89243S03TE / YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. The acetate salt is a separate record (UNII 00IBG87IQW). SRP pages do not print sequence, amide, CAS, UNII, salt stoichiometry, or a public COA. A method written for tesamorelin, CJC-1295, ipamorelin, or recombinant GH is not automatically valid for this vial.
Confirm peptide identity, C-terminal amide, stereochemistry, salt, and purity by LC-MS before treating a vial as the literature article. Historical Geref diagnostic schedules are study / label conditions. They are not a reconstitution scheme. Those schedules are not copied here.
No reconstitution scheme, no administration route, and no human or veterinary use protocol appears on this page. Research use only.
Frequently asked questions
Is sermorelin the same as GHRH?
It is the amidated 1–29 N-terminal fragment of human GHRH, not the intact 44-aa hormone (somatorelin).
Is sermorelin the same as tesamorelin?
No. Tesamorelin (TH9507 / Egrifta) is a different, stabilized analog. Most CT.gov collisions are tesamorelin.
Is sermorelin the same as CJC-1295?
No. DAC status and extra substitutions change identity and PK.
Is sermorelin growth hormone?
No. It is a GHRH-receptor agonist. It does not replace GH.
Is Geref still an FDA-marketed drug?
Opened IUPHAR marks sermorelin withdrawn. openFDA current search: no matches. Historical approval year 1990 is not current marketing.
Does “Sermorelin Acetate” on the SRP page prove Geref-equivalent salt?
No. Vendor alias only. Confirm on a COA / LC-MS. Acetate UNII 00IBG87IQW / CAS 114466-38-5 is a separate record from free-base CID 16132413 / UNII 89243S03TE.
Is there a sermorelin NCT?
NCT00324064 used named Geref in a diagnostic GH test. Do not treat tesamorelin NCTs as sermorelin.
Can these findings be used as dosing or administration instructions?
No. This page does not provide reconstitution, administration, or dosing instructions. Research use only. Zero dose figures are printed on this page.
Does this page include human dosing?
No. There is no human dosing, reconstitution, or administration protocol on this page. Research use only. Not medical advice. Not for human use.
Sources actually opened for this draft
- Prakash A, Goa KL. Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency. BioDrugs. 1999;12(2):139-157. PMID 18031173. DOI 10.2165/00063030-199912020-00007. Review. Abstract.
- Walker RF. Sermorelin: a better approach to management of adult-onset growth hormone insufficiency? Clin Interv Aging. 2006;1(4):307-308. PMID 18046908. DOI 10.2147/ciia.2006.1.4.307. Commentary. Record opened (empty abstract).
- Thorner MO, Vance ML, Evans WS, et al. Growth hormone releasing hormone. Clin Endocrinol Metab. 1986;15(3):453-474. PMID 2429796. DOI 10.1016/s0300-595x(86)80012-3. GHRH identity review. Abstract.
- Chen Y, Li ZY, Zhou GW, et al. A potentially effective drug for patients with recurrent glioma: sermorelin. Ann Transl Med. 2021;9(8):632. PMID 33842627. DOI 10.21037/atm-20-6561. In silico. Abstract.
- ClinicalTrials.gov NCT00324064 (Geref + arginine diagnostic testing). API JSON opened 16 August 2026. Unused tesamorelin collisions logged in the source log.
- IUPHAR/BPS Guide to PHARMACOLOGY ligand 6998 (sermorelin; FDA 1990; withdrawn true; CAS 86168-78-7; INN 6036). ligand 6998 and services
/ligands/6998+/interactions. - PubChem CID 16132413 (Sermorelin; CAS 86168-78-7; UNII 89243S03TE). https://pubchem.ncbi.nlm.nih.gov/compound/16132413
- NCATS UNII 89243S03TE (SERMORELIN; US Previously Marketed; GEREF / EMD SERONO; 1990). 89243S03TE
- NCATS UNII 00IBG87IQW (SERMORELIN ACETATE; CAS 114466-38-5; PubChem 91820622). 00IBG87IQW
- openFDA Drugs@FDA
generic_name:sermorelinandbrand_name:GEREF— no matches. Opened 16 August 2026. - Federal Register 78 FR 14095 (FR Doc 2013-04827, 4 March 2013). Determination that GEREF (sermorelin acetate) products were not withdrawn for safety or effectiveness; NDA 19-863 and NDA 20-443 withdrawn effective 18 June 2009. FR-2013-03-04 / 2013-04827
- SRP pages (opened 16 August 2026): 10 mg http://simpleresearchpeptides.com/product/sermorelin-10-mg-vial/; index compound-research-guides; dedicated-guide guess http://simpleresearchpeptides.com/research-compound-directory/sermorelin-research/ (404). For laboratory research only. Not for human or animal use.
Allowed PMID list used on this page: 18031173, 18046908, 2429796, 33842627. Allowed NCT: NCT00324064 only.
Educational information only. The SRP listing Sermorelin 10 mg is a research peptide corresponding, on opened registries, to sermorelin / GRF(1–29)-NH2 (CID 16132413; CAS 86168-78-7; UNII 89243S03TE; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; C149H246N44O42S; 3357.9 g/mol). Historical Geref acetate (UNII 00IBG87IQW) is withdrawn and is not established as the SRP lot. Not tesamorelin. Not CJC-1295. Not GH. Laboratory research use only; not for human or animal use. Not medical advice. Not for human use. No human dosing protocol. Zero dose figures on this page. Last source review: 16 August 2026 (America/Indianapolis). For laboratory research only. Not for human or veterinary use.
| Identifier | Value on opened page | Source opened |
|---|---|---|
| Peptide sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR with C-terminal amide | CID 16132413 synonym block; NCATS protein subunit; IUPHAR ligand 6998 comment GRF1-29-NH2 |
| PubChem title | Sermorelin | PubChem PUG REST name sermorelin |
| PubChem CID (amide / free-base record used here) | 16132413 | PubChem PUG |
| Alternate PubChem CID (stereochemistry unspecified) | 16129620 — IUPHAR comment only. Not used as the identity CID. | IUPHAR ligand 6998 HTML |
| CAS (sermorelin) | 86168-78-7 | PubChem synonym; NCATS; IUPHAR |
| UNII (sermorelin) | 89243S03TE | PubChem; 89243S03TE title SERMORELIN |
| Formula / MW | C149H246N44O42S; 3357.9 g/mol | PubChem PUG |
| Exact / monoisotopic mass | 3356.8220541 / 3355.8186992 | PubChem PUG |
| InChIKey | WGWPRVFKDLAUQJ-MITYVQBRSA-N | PubChem PUG |
| ChEBI / DrugBank / INN | CHEBI:9118 / DB00010 / 6036 | PubChem; NCATS; IUPHAR |
| IUPHAR / GtoPdb | Ligand 6998; Peptide; INN sermorelin; Approved drug? Yes (FDA 1990); Withdrawn drug? Yes | IUPHAR HTML + services JSON |
| ATC / RxCUI / MeSH | H01AC04; V04CD03 / 56188 / D017337 | PubChem / NCATS |
| EPA DSSTox | DTXSID70903978 | PubChem; NCATS |
| NCATS Inxight (free base) | SERMORELIN; US Previously Marketed; GEREF by EMD SERONO; Approval Year 1990; sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR (29 aa) | 89243S03TE |
| Acetate salt UNII (kept separate) | 00IBG87IQW — SERMORELIN ACETATE; CAS 114466-38-5; PubChem CID 91820622; USAN / Orange Book language on NCATS; also US Previously Marketed / GEREF 1990 | 00IBG87IQW |
| openFDA Drugs@FDA | generic_name:sermorelin and brand_name:GEREF → no matches (consistent with withdrawal / no current listing) |
openFDA, opened 16 August 2026 |
| ClinicalTrials.gov | query.intr=sermorelin totalCount 27; query.term=sermorelin totalCount 42. Most opened hits are tesamorelin / generic GHRH. Verified sermorelin (Geref) record: NCT00324064 |
CT.gov API v2 |
| SRP listing | 10 mg vial; AKA GRF(1-29), Sermorelin Acetate; Growth Hormone Research | SRP product page |
Registry chaos that must not be collapsed. Acetate UNII 00IBG87IQW / CAS 114466-38-5 / CID 91820622 is the salt record. Do not treat it as a second peptide. IUPHAR CID 16129620 is a stereochemistry-unspecified representation. Not the identity CID used here. Tesamorelin (TH9507 / Egrifta) is a stabilized GHRH analog, not sermorelin. Most CT.gov sermorelin / intr=sermorelin hits are tesamorelin or unspecified GHRH. CJC-1295 DAC, CJC-1295 no DAC, and modified GRF(1–29) are different sequences / PK designs. Intact human GHRH is 44 aa (somatorelin; IUPHAR ligand 2270). Sermorelin is residues 1–29-NH2.
One-sentence identity restated: Sermorelin is the synthetic C-terminally amidated 29-residue N-terminal fragment of human GHRH with opened sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (CID 16132413; CAS 86168-78-7; UNII 89243S03TE; formula C149H246N44O42S; MW 3357.9 g/mol). The historical US product was the acetate salt (UNII 00IBG87IQW; CAS 114466-38-5; Geref; FDA 1990; withdrawn on opened IUPHAR). A research-market 10 mg vial is not established as equivalent to withdrawn Geref. This page prints zero dose figures.
Thorner / GHRH identity review
PMID 2429796: human GHRH 44-aa amide and C-terminal-shortened derivatives. Identity context only. Distinguishes full-length GHRH from fragments.
Historical Geref approvals
NDA 19-863 (GEREF diagnostic; initially approved 28 December 1990) and NDA 20-443 (GEREF pediatric GHD / growth-failure product; initially approved 26 September 1997), both held by EMD Serono. Listed-drug strengths from later Federal Register text are not copied here.
Prakash & Goa review
PMID 18031173: 29-aa analog; shortest synthetic peptide with full GHRH activity. Historical diagnostic / idiopathic-GHD review. Not a protocol. Dose figures not copied.
Walker commentary
PMID 18046908: title-level commentary on adult-onset GH insufficiency. Empty abstract on the opened record. Not efficacy proof.
Withdrawal and Federal Register determination
Both NDAs discontinued in 2008; FDA withdrew both NDA approvals effective 18 June 2009. 78 FR 14095 (FR Doc 2013-04827, 4 March 2013): products were not withdrawn for safety or effectiveness. IUPHAR: withdrawn true. openFDA current search: no matches.
NCT00324064 named Geref diagnostic test
NCT00324064: GHRH(Geref) + arginine adult GH testing. COMPLETED. No results posted. Not an SRP-vial study. Dose figures from that record are not copied.
Chen in-silico glioma screen
PMID 33842627: computational association. Not a clinical trial. Not used as efficacy evidence.
SRP index / product / dedicated URL
Product page prints name, 10 mg / 3 mL, AKA GRF(1-29) / Sermorelin Acetate, RUO footer. Price not printed. Sequence, amide, CAS, UNII, salt stoichiometry, and a public COA were not printed. Index tags Evidence profile. Dedicated sermorelin-research URL returned HTTP 404. Free-base CID 16132413 kept separate from acetate / Geref records.
Workspace / index check (16 August 2026). The opened SRP index tags Sermorelin (10 mg Vial) as Evidence profile (not Dedicated evidence guide). Opened dedicated-guide URL returned HTTP 404. This HTML is a locked conversion of the citation-verified facts draft for that missing page. Not published. Not for WordPress in this pass.
Suggested slug recorded in the locked draft: sermorelin-research. Status: locked citation-verified draft converted to a standalone facts page. Do not add PMIDs, NCTs, CAS, UNII, or CIDs that are not on the allowed identifier list. Allowed PMIDs: 18031173, 18046908, 2429796, 33842627. Allowed NCT: NCT00324064 only. Free-base identity: CID 16132413 / CAS 86168-78-7 / UNII 89243S03TE. Acetate / Geref kept separate: UNII 00IBG87IQW / CAS 114466-38-5 / CID 91820622.
Free base vs acetate / Geref — do not collapse
This page uses the amidated free-base record as the identity CID: 16132413 / CAS 86168-78-7 / UNII 89243S03TE. The historical US product was the acetate salt: UNII 00IBG87IQW / CAS 114466-38-5 / PubChem CID 91820622 / Geref®. Those acetate / Geref identifiers are recorded so they are not lost, and so they are not treated as a second peptide or as proof that an SRP 10 mg research vial is Geref-equivalent. Vendor language “Sermorelin Acetate” on the opened SRP page is an alias, not a COA and not acetate stoichiometry. IUPHAR ligand 6998 marks sermorelin withdrawn. openFDA current Drugs@FDA searches for generic_name:sermorelin and brand_name:GEREF returned no matches on 16 August 2026. Unused tesamorelin collisions logged in the source log and not cited as sermorelin evidence: NCT00123253, NCT00795210, NCT06554717, NCT02012556. Historical Geref diagnostic schedules and listed-drug strengths from the Federal Register notice are study / label conditions and are not copied here as a protocol. Confirm sequence, C-terminal amide, stereochemistry, and salt on a COA / LC-MS before treating a research-market vial as the withdrawn product. Zero dose figures are printed on this page.