TB-500
Also known as: Thymosin beta-4 (parent protein), Tβ4
Quick summary
TB-500 is the name used for synthetic material related to thymosin beta-4, a 43-amino-acid protein that regulates actin. Research focus: wound repair models, angiogenesis and cell migration. This page leads with SRP's low-and-slow starting dose.
Amino acid sequence (one-letter code): SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Overview
TB-500 is the name used for synthetic material related to thymosin beta-4, a 43-amino-acid protein that regulates actin. Published research mostly uses full-length thymosin beta-4, not the commercial fragment.
Looking for research material? Simple Research Peptides lists TB-500 10 mg Tissue Research Peptide Vial for laboratory research use.
Mechanism
Thymosin beta-4 holds onto G-actin, which controls how readily cells can build their internal scaffolding and move. Its active region (LKKTETQ) is linked to cell migration and new blood-vessel formation in wound models. TB-500 is a synthetic peptide modeled on that region.
Research areas
- wound repair models
- angiogenesis
- cell migration
Storage & reconstitution
Typically supplied as a lyophilized powder; keep sealed vials cold (refrigerated short term, frozen for long-term holding) and away from light. Laboratories commonly reconstitute with bacteriostatic or sterile water, swirling gently rather than shaking, and keep the solution refrigerated, using it within a few weeks.
Recommended starting dose (low and slow)
| Starting dose | 2-2.5 mg per administration during a loading phase (; ranges begin at 2-2.5 mg). |
|---|---|
| Frequency | Reported schedules: 2x weekly (loading), then 1x weekly; 2–5mg weekly, split 2x; Twice weekly; 2x weekly. |
| Reconstitution | Examples: 5 mg vial + 2.5 mL bacteriostatic water = 2 mg/mL; 10mg vial + 2mL diluent (as listed). Different water volumes can be used; that only changes the draw volume, not the amount of peptide. storage note: Reconstituted: refrigerate, used within 4–6 weeks. |
Studied higher doses
Studies have used doses up to the amounts below. Higher doses can be dangerous. Whether a person can reach them safely depends on height, weight, activity level, training and pre-existing conditions. We recommend following the lower starting dose above, and contacting SRP with any questions.
| Highest amount reported in studies | 5 mg per administration (; counts 5 mg per week) or about 4-5 mg per week in loading phase. quotes rodent doses of 2-10 mg per administration. an intravenous healthy-volunteer study (confirmed) that is a different route and dose. |
|---|---|
| Step-up schedules reported | Loading then maintenance rather than step-ups: describes about 2-2.5 mg twice weekly for weeks 1-6, then 2-2.5 mg once weekly for weeks 7-12, then 4-8 weeks off; twice weekly then once weekly. |
Route and timing
Route: Subcutaneous or intramuscular injection.
Timing: Pending - to be added by SRP
Cycle length and repeat
Pending - to be added by SRP
Half-life
Approximate, for Bobby's review: Not well characterized in published research.
Side effects
Pending - to be added by SRP
Suggested bloodwork and monitoring
Draft, for Bobby's review: CBC and comprehensive metabolic panel (kidney and liver function, electrolytes) before starting and again after a few weeks.
Cautions
Pending - to be added by SRP
Reconstitution calculator
Math aid only. It converts the numbers you enter; it is not dosing advice. For research use only. Prefilled with this page's vial size, reconstitution and low-and-slow starting dose where known; change any value.
Frequently asked questions
What is TB-500 studied for?
In research it is studied for wound repair models, angiogenesis and cell migration. Thymosin beta-4 holds onto G-actin, which controls how readily cells can build their internal scaffolding and move.
How is TB-500 given in research?
Subcutaneous or intramuscular injection. See the dosing frequency block on this page for how often.
What amount should a researcher start with?
This page lists SRP's low-and-slow starting dose in the Recommended starting dose section. Higher amounts that appear in studies are listed separately with their safety context. Start with the lower dose and contact SRP with any questions.
Related peptides
Last updated: October 19, 2026