BPC-157 + TB-500 Blend (Wolverine)
Quick summary
The store's BPC-157 and TB-500 blends in several strengths. Research focus: tissue repair models. This page leads with SRP's low-and-slow starting dose.
Component structures:
Amino acid sequence (one-letter code): GEPPPGKPADDAGLV
Amino acid sequence (one-letter code): SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Overview
The store's BPC-157 and TB-500 blends in several strengths. See the Stacks page and each component's page.
Looking for research material? Simple Research Peptides lists BPC-157 + TB-500 (10/10 mg Vial) Wolverine Healing Stack for laboratory research use.
Mechanism
This blend combines its components, each acting through its own pathway. See the linked component pages for how each one works.
Research areas
- tissue repair models
Storage & reconstitution
Supplied as a freeze-dried (lyophilized) powder in a sealed vial. Unopened vials are generally kept cold and away from light. Labs usually reconstitute it with bacteriostatic or sterile water, letting the liquid run down the vial wall and swirling gently instead of shaking. The solution is then kept refrigerated.
Recommended starting dose (low and slow)
| Starting dose | Low end of the studied range: 500 mcg; 250 mcg. |
|---|---|
| Frequency | Reported schedules: daily; 250–500mcg each daily. |
| Reconstitution | Examples: 10 mg vial + 2 mL bacteriostatic water = 5 mg/mL; 20mg vial + 2mL diluent (as listed). storage note: Reconstituted: refrigerate, used within 4–6 weeks. |
Studied higher doses
Studies have used doses up to the amounts below. Higher doses can be dangerous. Whether a person can reach them safely depends on height, weight, activity level, training and pre-existing conditions. We recommend following the lower starting dose above, and contacting SRP with any questions.
| Highest amount reported in studies | Top of the studied range: 1 mg; 500 mcg. These are range tops, not verified ceilings. Reported amounts vary by 2x or more. |
|---|
Route and timing
Route: Subcutaneous injection after reconstitution is the route most often described in research protocols.
Timing: Pending - to be added by SRP
Cycle length and repeat
Pending - to be added by SRP
Half-life
Approximate, for Bobby's review: Not well characterized in published research.
Side effects
Pending - to be added by SRP
Suggested bloodwork and monitoring
Draft, for Bobby's review: CBC and comprehensive metabolic panel (kidney and liver function, electrolytes) before starting and again after a few weeks.
Cautions
Pending - to be added by SRP
Reconstitution calculator
Math aid only. It converts the numbers you enter; it is not dosing advice. For research use only. Prefilled with this page's vial size, reconstitution and low-and-slow starting dose where known; change any value.
Frequently asked questions
What is BPC-157 + TB-500 Blend (Wolverine) studied for?
In research it is studied for tissue repair models. This blend combines its components, each acting through its own pathway.
How is BPC-157 + TB-500 Blend (Wolverine) given in research?
Subcutaneous injection after reconstitution is the route most often described in research protocols. See the dosing frequency block on this page for how often.
What amount should a researcher start with?
This page lists SRP's low-and-slow starting dose in the Recommended starting dose section. Higher amounts that appear in studies are listed separately with their safety context. Start with the lower dose and contact SRP with any questions.
Related peptides
Last updated: October 19, 2026