Kisspeptin-54
Quick summary
The full-length 54-amino-acid form of kisspeptin, which activates the KISS1R receptor upstream of GnRH release. Research focus: KISS1R signaling and reproductive axis. SRP's starting dose for this compound is still pending.
Amino acid sequence (one-letter code): GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF
Overview
The full-length 54-amino-acid form of kisspeptin, which activates the KISS1R receptor upstream of GnRH release.
Looking for research material? Simple Research Peptides lists Kisspeptin-54 10mg for laboratory research use.
Mechanism
The full-length product of the KISS1 gene, acting through KISS1R.
Research areas
- KISS1R signaling
- reproductive axis
Storage & reconstitution
Supplied as a freeze-dried (lyophilized) powder in a sealed vial. Unopened vials are generally kept cold and away from light. Labs usually reconstitute it with bacteriostatic or sterile water, letting the liquid run down the vial wall and swirling gently instead of shaking. The solution is then kept refrigerated.
Recommended starting dose (low and slow)
| Starting dose | Pending - to be added by SRP |
|---|---|
| Frequency | Pending - to be added by SRP |
| Reconstitution | Pending - to be added by SRP |
Route and timing
Route: Subcutaneous injection after reconstitution is the route most often described in research protocols.
Timing: Pending - to be added by SRP
Cycle length and repeat
Pending - to be added by SRP
Half-life
Approximate, for Bobby's review: About 30 minutes.
Side effects
Pending - to be added by SRP
Suggested bloodwork and monitoring
Draft, for Bobby's review: CBC and comprehensive metabolic panel (kidney and liver function, electrolytes) before starting and again after a few weeks; the relevant reproductive hormones (for example LH, FSH, total and free testosterone or estradiol) and prolactin.
Cautions
Pending - to be added by SRP
Reconstitution calculator
Math aid only. It converts the numbers you enter; it is not dosing advice. For research use only.
Frequently asked questions
What is Kisspeptin-54 studied for?
In research it is studied for KISS1R signaling and reproductive axis. The full-length product of the KISS1 gene, acting through KISS1R.
How is Kisspeptin-54 given in research?
Subcutaneous injection after reconstitution is the route most often described in research protocols. SRP has not yet published a frequency for this compound.
What amount should a researcher start with?
SRP has not yet published a starting dose for Kisspeptin-54. Contact SRP before starting any research protocol, and do not guess.
Related peptides
Last updated: October 19, 2026